(data stored in ACNUC7421 zone)

EMBL: CP001700.PE382

CP001700.PE382       Location/Qualifiers
FT   CDS             426686..427390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0384"
FT                   /product="succinate dehydrogenase (or fumarate reductase)
FT                   cytochrome b subunit, b558 family"
FT                   /note="TIGRFAM: succinate dehydrogenase (or fumarate
FT                   reductase) cytochrome b subunit, b558 family; KEGG:
FT                   sco:SCO0924 cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69337"
FT                   /db_xref="GOA:C7PVI1"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI1"
FT                   /inference="protein motif:TFAM:TIGR02046"
FT                   /protein_id="ACU69337.1"
FT                   /translation="MVTATWTDRRPPSLRTAWDSSVGKKTVMAVSGLVMVLYLLAHAFG
FT                   NLKVFFGPGQFDSYAHWLRTMGEPVMHYSWTLWVIRVVMVLAVVAHTVSAYQLSRRDIR
FT                   ARPVRYEHRKAGSSYATRTMRWGGIILGLFIIWHLLDLTTGTVHSGFQPGHPYANVVST
FT                   FNHWYGDVIYIVAVCALGLHIQHGFWSAAQTLGVGSAKRDRLIKTTGNVVAVLLTLAFV
FT                   AVPVGVMSGVVK"
     MVTATWTDRR PPSLRTAWDS SVGKKTVMAV SGLVMVLYLL AHAFGNLKVF FGPGQFDSYA        60
     HWLRTMGEPV MHYSWTLWVI RVVMVLAVVA HTVSAYQLSR RDIRARPVRY EHRKAGSSYA       120
     TRTMRWGGII LGLFIIWHLL DLTTGTVHSG FQPGHPYANV VSTFNHWYGD VIYIVAVCAL       180
     GLHIQHGFWS AAQTLGVGSA KRDRLIKTTG NVVAVLLTLA FVAVPVGVMS GVVK             234
//

If you have problems or comments...

PBIL Back to PBIL home page