(data stored in ACNUC7421 zone)

EMBL: CP001700.PE383

CP001700.PE383       Location/Qualifiers
FT   CDS             427387..429336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0385"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /note="KEGG: sco:SCO0923 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69338"
FT                   /db_xref="GOA:C7PVI2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI2"
FT                   /inference="protein motif:TFAM:TIGR01811"
FT                   /protein_id="ACU69338.1"
FT                   /translation="MTDYTDYTVGDPIADAKAPAGPISERWDTRRFEAKLVNPANRRKR
FT                   TVIVIGTGLAGGSAGATLAEAGYHVVQFCFQDSPRRAHSIAAQGGINAAKNYRNDGDSV
FT                   HRLFYDTVKGGDFRSRESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQV
FT                   SRTFYARGQTGQQLLLGAYQAMMRQVAAGNIELHARTEMLDLIVVDGRARGIVARDLLT
FT                   GEISTYFGDAVVLASGGYGNVYYLSTNAMNSNATAIWRAHRKGAYFGNPCYTQIHPTCI
FT                   PRTGDHQSKLTLMSESLRNDGRIWVPKAKGDSRSPDAIPEDERDYYLERQYPSFGNLVP
FT                   RDIASRAAKNVCDEGRGVGPGGQGVYLDFADAIKRLGRKAVEEKYGNLFEMYQRITDED
FT                   PYRVPMRIYPAVHYTMGGLWVDYDLQTTVPGLFAVGEANFSDHGANRLGASALMQGLAD
FT                   GYFVLPATISDYLARHAGDVPVTADHPEAVAAVRETQERLDAILAVDGDRTPDSFHREL
FT                   GELMWELCGMARDEAGLRKALDQIPAIREEFWRRIKVPGTGEEFNQSLEKANRLVDYFE
FT                   LAELMCLDALHRGESCGGHFRTESQTPDGEAARKDEEFSYVAAWEYTGLGQAPVLHREE
FT                   LDFEYVHPAQRSYA"
     MTDYTDYTVG DPIADAKAPA GPISERWDTR RFEAKLVNPA NRRKRTVIVI GTGLAGGSAG        60
     ATLAEAGYHV VQFCFQDSPR RAHSIAAQGG INAAKNYRND GDSVHRLFYD TVKGGDFRSR       120
     ESNVHRLAQI SVEIIDQCVA QGVPFAREYG GLLDTRSFGG VQVSRTFYAR GQTGQQLLLG       180
     AYQAMMRQVA AGNIELHART EMLDLIVVDG RARGIVARDL LTGEISTYFG DAVVLASGGY       240
     GNVYYLSTNA MNSNATAIWR AHRKGAYFGN PCYTQIHPTC IPRTGDHQSK LTLMSESLRN       300
     DGRIWVPKAK GDSRSPDAIP EDERDYYLER QYPSFGNLVP RDIASRAAKN VCDEGRGVGP       360
     GGQGVYLDFA DAIKRLGRKA VEEKYGNLFE MYQRITDEDP YRVPMRIYPA VHYTMGGLWV       420
     DYDLQTTVPG LFAVGEANFS DHGANRLGAS ALMQGLADGY FVLPATISDY LARHAGDVPV       480
     TADHPEAVAA VRETQERLDA ILAVDGDRTP DSFHRELGEL MWELCGMARD EAGLRKALDQ       540
     IPAIREEFWR RIKVPGTGEE FNQSLEKANR LVDYFELAEL MCLDALHRGE SCGGHFRTES       600
     QTPDGEAARK DEEFSYVAAW EYTGLGQAPV LHREELDFEY VHPAQRSYA                   649
//

If you have problems or comments...

PBIL Back to PBIL home page