(data stored in ACNUC7421 zone)

EMBL: CP001700.PE384

CP001700.PE384       Location/Qualifiers
FT   CDS             429333..430082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0386"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; ferredoxin; KEGG: sco:SCO0922 succinate
FT                   dehydrogenase/fumarate reductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69339"
FT                   /db_xref="GOA:C7PVI3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACU69339.1"
FT                   /translation="MKLTLRVWRQENASRPGRMQPYEIDGVSRDMSFLEMLDVLNEKLI
FT                   LDGEDPVAFDHDCREGICGACSLMIDGEAHGPEKKTTTCQLHMRSFRDGATIDVEPWRA
FT                   AAFPVVKDLVVDRSALDRVIQSGGYITAPTGAAPEAHATPIPKPAADLAFENAECIGCG
FT                   ACVAACPNGSASLFTAAKINHLNTLPQGAPERETRVLTMLQQTDAEGFGGCTLTGECAT
FT                   ACPKGIPLASIAAMNKEWLRAQRKASR"
     MKLTLRVWRQ ENASRPGRMQ PYEIDGVSRD MSFLEMLDVL NEKLILDGED PVAFDHDCRE        60
     GICGACSLMI DGEAHGPEKK TTTCQLHMRS FRDGATIDVE PWRAAAFPVV KDLVVDRSAL       120
     DRVIQSGGYI TAPTGAAPEA HATPIPKPAA DLAFENAECI GCGACVAACP NGSASLFTAA       180
     KINHLNTLPQ GAPERETRVL TMLQQTDAEG FGGCTLTGEC ATACPKGIPL ASIAAMNKEW       240
     LRAQRKASR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page