(data stored in ACNUC7421 zone)

EMBL: CP001700.PE385

CP001700.PE385       Location/Qualifiers
FT   CDS             430499..431446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0387"
FT                   /product="sugar hydrolase"
FT                   /note="KEGG: sma:SAV_5252 sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69340"
FT                   /db_xref="GOA:C7PVI4"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI4"
FT                   /inference="similar to AA sequence:KEGG:SAV_5252"
FT                   /protein_id="ACU69340.1"
FT                   /translation="MPRTVRKSLIAGAAFLLPAAAVGVAAGASTAAAATHAASFPAHYS
FT                   APYLQISSSDAKDMAADMAASGDKFYTLAFLTPKSGCTPEWEDGGDSVGAFSSQITALQ
FT                   NAGGNVIISFGGAEGGELAQTCTSVSSLEAAYAKVVSTYHVTRLDFDIEGSVLDNKTAN
FT                   SRRDQALAALQKANPAVQVDFTLPVDPTGLESNATALLSDAKSKGVAVNLVNIMTMDFG
FT                   DGQNALKDAESGANATVPQLEKVFGVSSTKAWNMLGLTPIAGKNDDNENFTQANASTLE
FT                   SFAASKGVQELSFWEVDGYDKGVGYAYSKIFNKI"
     MPRTVRKSLI AGAAFLLPAA AVGVAAGAST AAAATHAASF PAHYSAPYLQ ISSSDAKDMA        60
     ADMAASGDKF YTLAFLTPKS GCTPEWEDGG DSVGAFSSQI TALQNAGGNV IISFGGAEGG       120
     ELAQTCTSVS SLEAAYAKVV STYHVTRLDF DIEGSVLDNK TANSRRDQAL AALQKANPAV       180
     QVDFTLPVDP TGLESNATAL LSDAKSKGVA VNLVNIMTMD FGDGQNALKD AESGANATVP       240
     QLEKVFGVSS TKAWNMLGLT PIAGKNDDNE NFTQANASTL ESFAASKGVQ ELSFWEVDGY       300
     DKGVGYAYSK IFNKI                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page