(data stored in ACNUC7421 zone)

EMBL: CP001700.PE386

CP001700.PE386       Location/Qualifiers
FT   CDS             431849..435232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0389"
FT                   /product="WGR domain-containing protein"
FT                   /note="KEGG: stp:Strop_2883 WGR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69341"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI5"
FT                   /inference="similar to AA sequence:KEGG:Strop_2883"
FT                   /protein_id="ACU69341.1"
FT                   /translation="MSGATNAPTAVSEDTCQIPGAMRRLVIPRRGDVPSEPVAVDPKAA
FT                   AYYAAWFDEQSPIVAGIVDHGHSEADLVEEYRASKGDLVIATPLAAAVAAAMTISQSTP
FT                   AYENPAGIVDAWIATRGLAFAAAAAVELFGVKTSGRTSKGEQASAWLCRKDGAYEDIPH
FT                   GIAVRVRQHLASAGEQDYAEVADVLARYRLSLASPTTSGQVLSRMLTSFLTPENVDWVE
FT                   SDFAFVSRAHYSAWLALASITTEEQVAALPAQKISAWGIARELSALWTALDNVGVHLLP
FT                   VLTGWLAPESDPESVQRLLSIVAGIASADAFRYLVDNIDKKYFTVATQNAATTFPRRAL
FT                   QILGDAALRDTPRGLAAANVLRLHIVAHDELVQDELANLTPAVRDHVEKIRAANVPVPD
FT                   AETDSLPTLFVSPPWLTAVKPARPVVITGLEAPTETVLAWRDGEKEQWASAELITNPQW
FT                   KLESWKDIADRISTGGSAGWYANGHFAVEAPEDLVRSVLTSWEPDSWQSDTWIPTLVMR
FT                   FGADALPPILSLARSVPASGAVFLAPFEAPEVALLAADWLSRLKTARPFALAWLTRHPG
FT                   FAARTLIPAALGKAGKARSAAELTIRTLAARGFTAEITEAAAGYGDAVAQAVAAIVADD
FT                   GTLTLPKTMPAVPDWAETRLLPQILLKGRQTALPEQSVKHLLLMLAVSKGTEPYAGIQM
FT                   AKGICDPASLATFSWALFENWRGVDYPAKESWAFDALRWFGDDETVRRLSPMIRLWPGE
FT                   NGHQRAVAGLDVLADIGGTVALMHLYGISQKVKFKGLKEQATQRVTEIADDLGLTAEQL
FT                   GDRLVPDLGLASSGTLSLDYGPRSFTVGFDEQLKPYVADQSGKRLKALPKPGAKDDQEL
FT                   APAAHQQFSALKKDVRTLAASQIARFELAMVTQRRWTSQEFGEYFVGHPLLRHLVRRLV
FT                   WVTFVDEKVGSAFRVAEDLSLADIADDEFTLADDAVIGVAHPLHIGGDVAAWSDVFADY
FT                   EILQPFAQLGRTVFAFTDAEKASTRLTRFGGIETPVGKVLGLERRGWRRGAPQDAGIQG
FT                   WISRALLGGGSVTATLDPGITVDYVAEWGETQRLQEVFISRHADGESYWNASAKFRELG
FT                   SLDEITASELLRDLTEATTQ"
     MSGATNAPTA VSEDTCQIPG AMRRLVIPRR GDVPSEPVAV DPKAAAYYAA WFDEQSPIVA        60
     GIVDHGHSEA DLVEEYRASK GDLVIATPLA AAVAAAMTIS QSTPAYENPA GIVDAWIATR       120
     GLAFAAAAAV ELFGVKTSGR TSKGEQASAW LCRKDGAYED IPHGIAVRVR QHLASAGEQD       180
     YAEVADVLAR YRLSLASPTT SGQVLSRMLT SFLTPENVDW VESDFAFVSR AHYSAWLALA       240
     SITTEEQVAA LPAQKISAWG IARELSALWT ALDNVGVHLL PVLTGWLAPE SDPESVQRLL       300
     SIVAGIASAD AFRYLVDNID KKYFTVATQN AATTFPRRAL QILGDAALRD TPRGLAAANV       360
     LRLHIVAHDE LVQDELANLT PAVRDHVEKI RAANVPVPDA ETDSLPTLFV SPPWLTAVKP       420
     ARPVVITGLE APTETVLAWR DGEKEQWASA ELITNPQWKL ESWKDIADRI STGGSAGWYA       480
     NGHFAVEAPE DLVRSVLTSW EPDSWQSDTW IPTLVMRFGA DALPPILSLA RSVPASGAVF       540
     LAPFEAPEVA LLAADWLSRL KTARPFALAW LTRHPGFAAR TLIPAALGKA GKARSAAELT       600
     IRTLAARGFT AEITEAAAGY GDAVAQAVAA IVADDGTLTL PKTMPAVPDW AETRLLPQIL       660
     LKGRQTALPE QSVKHLLLML AVSKGTEPYA GIQMAKGICD PASLATFSWA LFENWRGVDY       720
     PAKESWAFDA LRWFGDDETV RRLSPMIRLW PGENGHQRAV AGLDVLADIG GTVALMHLYG       780
     ISQKVKFKGL KEQATQRVTE IADDLGLTAE QLGDRLVPDL GLASSGTLSL DYGPRSFTVG       840
     FDEQLKPYVA DQSGKRLKAL PKPGAKDDQE LAPAAHQQFS ALKKDVRTLA ASQIARFELA       900
     MVTQRRWTSQ EFGEYFVGHP LLRHLVRRLV WVTFVDEKVG SAFRVAEDLS LADIADDEFT       960
     LADDAVIGVA HPLHIGGDVA AWSDVFADYE ILQPFAQLGR TVFAFTDAEK ASTRLTRFGG      1020
     IETPVGKVLG LERRGWRRGA PQDAGIQGWI SRALLGGGSV TATLDPGITV DYVAEWGETQ      1080
     RLQEVFISRH ADGESYWNAS AKFRELGSLD EITASELLRD LTEATTQ                    1127
//

If you have problems or comments...

PBIL Back to PBIL home page