(data stored in ACNUC7421 zone)

EMBL: CP001700.PE387

CP001700.PE387       Location/Qualifiers
FT   CDS             complement(435538..436866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0390"
FT                   /product="Putative cell wall-binding domain-like protein"
FT                   /note="KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69342"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI6"
FT                   /inference="protein motif:COG:COG2247"
FT                   /protein_id="ACU69342.1"
FT                   /translation="MATTAHAGTAPHPAVAMAAVNVPAPPSGVSRISGGDRYLTGVQVS
FT                   QSQWADAGGDATGRAPAQAVVLARGDTFPDALSGVPLAAKVHGPLLLTTPAALSAGTAA
FT                   EIRRVLGPGAGQPVYILGGTGAVSPSVEAQLVRDGYAVTRYQGSNRYQTALDVARRGLG
FT                   DPARIVVATGDGYADALAAGPFAAGPDAVGGVPAAVVLSDGRSLDPATAAYVSGKLAAA
FT                   APGDCNAVTTVGGQAGTAVQAVTPAGSCTNPLAGADRYATAVAVAQQFPAGTSVGVATG
FT                   GGFADALTGGAAMAALGRPLVLTDPAVLGDNPRLWLVGAHQGGVGATAVFGGPSAVGGE
FT                   VFTQLQDIANGGAGLPTNALCGAPANPYGFNYCGVGSEVTVKAVPAAICSYFSCIGTDS
FT                   AHTSFWRGLGYLEVCDDGDISLSGGRSGACSSHGGENHPVWKR"
     MATTAHAGTA PHPAVAMAAV NVPAPPSGVS RISGGDRYLT GVQVSQSQWA DAGGDATGRA        60
     PAQAVVLARG DTFPDALSGV PLAAKVHGPL LLTTPAALSA GTAAEIRRVL GPGAGQPVYI       120
     LGGTGAVSPS VEAQLVRDGY AVTRYQGSNR YQTALDVARR GLGDPARIVV ATGDGYADAL       180
     AAGPFAAGPD AVGGVPAAVV LSDGRSLDPA TAAYVSGKLA AAAPGDCNAV TTVGGQAGTA       240
     VQAVTPAGSC TNPLAGADRY ATAVAVAQQF PAGTSVGVAT GGGFADALTG GAAMAALGRP       300
     LVLTDPAVLG DNPRLWLVGA HQGGVGATAV FGGPSAVGGE VFTQLQDIAN GGAGLPTNAL       360
     CGAPANPYGF NYCGVGSEVT VKAVPAAICS YFSCIGTDSA HTSFWRGLGY LEVCDDGDIS       420
     LSGGRSGACS SHGGENHPVW KR                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page