(data stored in ACNUC7421 zone)

EMBL: CP001700.PE388

CP001700.PE388       Location/Qualifiers
FT   CDS             complement(437082..437510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0391"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   ace:Acel_0050 FMN-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69343"
FT                   /db_xref="GOA:C7PVI7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI7"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ACU69343.1"
FT                   /translation="MRIPLIKTLLSLAGTVGTMGGLLAMKTSAHGLAPQPLQAAKVVHD
FT                   RTAGATMTVTGPAIPVTHGIVQVRITLTDGHITDVSATSLPHDNDDSWTRSVTAAMVLD
FT                   REVIAKQSAHIDGVSGATYTSKAYKASLQAAIDAGYRH"
     MRIPLIKTLL SLAGTVGTMG GLLAMKTSAH GLAPQPLQAA KVVHDRTAGA TMTVTGPAIP        60
     VTHGIVQVRI TLTDGHITDV SATSLPHDND DSWTRSVTAA MVLDREVIAK QSAHIDGVSG       120
     ATYTSKAYKA SLQAAIDAGY RH                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page