(data stored in ACNUC7421 zone)

EMBL: CP001700.PE389

CP001700.PE389       Location/Qualifiers
FT   CDS             complement(437531..438940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0392"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; FAD-binding 8 domain protein; Ferric reductase
FT                   domain protein transmembrane component domain; KEGG:
FT                   fal:FRAAL0548 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69344"
FT                   /db_xref="GOA:C7PVI8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACU69344.1"
FT                   /translation="MVQGWSAGFEVPYDPDWVVPRRDWRHSLPLLPRRPLSAVLLAVLA
FT                   AGIAGLLALWWQETPADRMQSLPDYLVMLAQITGLVGAYLLLVEIALMARLPWLEHRLG
FT                   SWLASAHRSLGGYLVLLLCAHVGFVIAAYSVSVHDSPPAVLVSILRTYPGVLAATIGFL
FT                   VMLLAGFTSARSIRRRLGYEGWHAIHLLMYPAAAAAFWHQITLGAQFTRNPWAADVWVG
FT                   LHAVVGAAIVCNRIVIPLLNNRHHRFRVSRVEAVGPDAMNVYITGRRVADLGAEAGQYF
FT                   RWRFMQRSLWYQAHPFSLSAAPHADTLRLTFKCVGGYTRRLKRRLRPGSRVFLDGPYGA
FT                   FTGVLRRQPGVVMIGGGIGVTPLRAIVETMHNRRRNDIIFIQRASKVGDLILTNELEAL
FT                   NAVGRIIYIPAIGSRRNDPLSADRLLDLIPDLEFREVFICGSVGMAAAAVRNLRRAGVR
FT                   RGRIHTEIFDF"
     MVQGWSAGFE VPYDPDWVVP RRDWRHSLPL LPRRPLSAVL LAVLAAGIAG LLALWWQETP        60
     ADRMQSLPDY LVMLAQITGL VGAYLLLVEI ALMARLPWLE HRLGSWLASA HRSLGGYLVL       120
     LLCAHVGFVI AAYSVSVHDS PPAVLVSILR TYPGVLAATI GFLVMLLAGF TSARSIRRRL       180
     GYEGWHAIHL LMYPAAAAAF WHQITLGAQF TRNPWAADVW VGLHAVVGAA IVCNRIVIPL       240
     LNNRHHRFRV SRVEAVGPDA MNVYITGRRV ADLGAEAGQY FRWRFMQRSL WYQAHPFSLS       300
     AAPHADTLRL TFKCVGGYTR RLKRRLRPGS RVFLDGPYGA FTGVLRRQPG VVMIGGGIGV       360
     TPLRAIVETM HNRRRNDIIF IQRASKVGDL ILTNELEALN AVGRIIYIPA IGSRRNDPLS       420
     ADRLLDLIPD LEFREVFICG SVGMAAAAVR NLRRAGVRRG RIHTEIFDF                   469
//

If you have problems or comments...

PBIL Back to PBIL home page