(data stored in ACNUC7421 zone)

EMBL: CP001700.PE39

CP001700.PE39        Location/Qualifiers
FT   CDS             complement(42621..43256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0039"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   sgr:SGR_3722 putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68994"
FT                   /db_xref="GOA:C7QFQ5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ5"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACU68994.1"
FT                   /translation="MAARILVVDNYDSFVYNLVQYLYQLGAECEVVRNDAIGVEAAHDY
FT                   DGVLLSPGPGTPEEAGVCVAMTGYAEQHRIPVFGVCLGLQSIAVAHGAVVGRAPELLHG
FT                   KTSKVTHDGAGVFQGLPDPFTATRYHSLAIEPETLPQDLLVTARTDSGVIMGIRHRELP
FT                   VEAVQFHPESVLTEGGHRMLANWLTVCGDAGAVERSAGLAPVVLSAAN"
     MAARILVVDN YDSFVYNLVQ YLYQLGAECE VVRNDAIGVE AAHDYDGVLL SPGPGTPEEA        60
     GVCVAMTGYA EQHRIPVFGV CLGLQSIAVA HGAVVGRAPE LLHGKTSKVT HDGAGVFQGL       120
     PDPFTATRYH SLAIEPETLP QDLLVTARTD SGVIMGIRHR ELPVEAVQFH PESVLTEGGH       180
     RMLANWLTVC GDAGAVERSA GLAPVVLSAA N                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page