(data stored in ACNUC7421 zone)

EMBL: CP001700.PE390

CP001700.PE390       Location/Qualifiers
FT   CDS             complement(439201..439677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0393"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: mxa:MXAN_2836 Aha1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69345"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI9"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACU69345.1"
FT                   /translation="MTTQKIQIERTYPAAPEKIWELWTTAAGIESWWAPEGFDVHVETL
FT                   ELKPGGALVYTMTAVGPDQVAFMEQVGLPLSTTSTKAFTEVEPVRRLAYTSLADFIPGV
FT                   EPYDFLTEVELRPTADGGTHVVMTADAMHDEEWTGRLSAGRTNEMDNLGKVVGE"
     MTTQKIQIER TYPAAPEKIW ELWTTAAGIE SWWAPEGFDV HVETLELKPG GALVYTMTAV        60
     GPDQVAFMEQ VGLPLSTTST KAFTEVEPVR RLAYTSLADF IPGVEPYDFL TEVELRPTAD       120
     GGTHVVMTAD AMHDEEWTGR LSAGRTNEMD NLGKVVGE                               158
//

If you have problems or comments...

PBIL Back to PBIL home page