(data stored in ACNUC7421 zone)

EMBL: CP001700.PE391

CP001700.PE391       Location/Qualifiers
FT   CDS             complement(439714..441039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0394"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   saq:Sare_2937 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69346"
FT                   /db_xref="GOA:C7PVJ0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ0"
FT                   /inference="protein motif:TFAM:TIGR02960"
FT                   /protein_id="ACU69346.1"
FT                   /translation="MKARSCQVCGAALSDRGRGRTSVYCSAACRQRAYRLRHTTADQSA
FT                   ADVLAEIERQVRTLALRPPQSFRTDADALATTVRRLRRLAQNVTPEPVTKSAAEEQPPQ
FT                   LAGEPGFAALVEPHRKWLHLHCYRMAGSYDDAEDLVQETLLKAWRDRSGFEGRAAARTW
FT                   LYRIATNVCIDHLRRTGRRPQRYESTATSGAAEPPERMAWLQPYPDQLLDEAVAEDEHP
FT                   EAAAVSRETMELVFLATLQHLPPRQRAVLIFRDVLGRPAEETATLMDMSVAAANSALQR
FT                   ARQTLRERLPQRRTDWTRGDHSRQEQEIVRRYMAAAERSDVSMMADLLSADVLVTMPPN
FT                   PVWFAGRDALLTQIGPLFDRTSPGYFGRWRHLPVGANRLPAVAGYVQRPGTSVFRAQMV
FT                   DVLRIEAGQIMEITTFEAHLVAAFGLPLTLPMTDRPGARPTL"
     MKARSCQVCG AALSDRGRGR TSVYCSAACR QRAYRLRHTT ADQSAADVLA EIERQVRTLA        60
     LRPPQSFRTD ADALATTVRR LRRLAQNVTP EPVTKSAAEE QPPQLAGEPG FAALVEPHRK       120
     WLHLHCYRMA GSYDDAEDLV QETLLKAWRD RSGFEGRAAA RTWLYRIATN VCIDHLRRTG       180
     RRPQRYESTA TSGAAEPPER MAWLQPYPDQ LLDEAVAEDE HPEAAAVSRE TMELVFLATL       240
     QHLPPRQRAV LIFRDVLGRP AEETATLMDM SVAAANSALQ RARQTLRERL PQRRTDWTRG       300
     DHSRQEQEIV RRYMAAAERS DVSMMADLLS ADVLVTMPPN PVWFAGRDAL LTQIGPLFDR       360
     TSPGYFGRWR HLPVGANRLP AVAGYVQRPG TSVFRAQMVD VLRIEAGQIM EITTFEAHLV       420
     AAFGLPLTLP MTDRPGARPT L                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page