(data stored in ACNUC7421 zone)

EMBL: CP001700.PE392

CP001700.PE392       Location/Qualifiers
FT   CDS             complement(441225..441893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69347"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ1"
FT                   /inference="similar to AA sequence:KEGG:SAV_696"
FT                   /protein_id="ACU69347.1"
FT                   /translation="MQKFETPSPVTVVLDIPAGQIRLVAGERADTVVEVLPSEASKRRD
FT                   AKAAAQTTVEFSGGVLRIATADPHKILGSSGSLDVTIALPAGSRIEGKAGAAELHSTGR
FT                   LGEVAFDGGYRSVELDEVAGARIKMHMGDVSIAKLTGPAQLRNGKGDITVAEAAGGAVD
FT                   LRTDMGDLKIAAAPGVSGTLDASSASGRITNALKNSEGAGAGLNIKATTSHGDIIATSL
FT                   "
     MQKFETPSPV TVVLDIPAGQ IRLVAGERAD TVVEVLPSEA SKRRDAKAAA QTTVEFSGGV        60
     LRIATADPHK ILGSSGSLDV TIALPAGSRI EGKAGAAELH STGRLGEVAF DGGYRSVELD       120
     EVAGARIKMH MGDVSIAKLT GPAQLRNGKG DITVAEAAGG AVDLRTDMGD LKIAAAPGVS       180
     GTLDASSASG RITNALKNSE GAGAGLNIKA TTSHGDIIAT SL                          222
//

If you have problems or comments...

PBIL Back to PBIL home page