(data stored in ACNUC7421 zone)

EMBL: CP001700.PE393

CP001700.PE393       Location/Qualifiers
FT   CDS             complement(442044..442469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0396"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   sma:SAV_4279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69348"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ2"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ACU69348.1"
FT                   /translation="MSISLVQAEAVVAAARVGADERGVAVAFAVVDAGGNLVAFARGDG
FT                   ANLITVDTAIGKAFTAISIGADSINLTAAIQPGGPLFGTGLVLAGARSFVPYGGGVLIR
FT                   VDGRVVGALGIAGAASSEVDHEIAAAAAVQVPVRVAA"
     MSISLVQAEA VVAAARVGAD ERGVAVAFAV VDAGGNLVAF ARGDGANLIT VDTAIGKAFT        60
     AISIGADSIN LTAAIQPGGP LFGTGLVLAG ARSFVPYGGG VLIRVDGRVV GALGIAGAAS       120
     SEVDHEIAAA AAVQVPVRVA A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page