(data stored in ACNUC7421 zone)

EMBL: CP001700.PE394

CP001700.PE394       Location/Qualifiers
FT   CDS             complement(442903..444330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0397"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_4; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sma:SAV_4421 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69349"
FT                   /db_xref="GOA:C7PVJ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ3"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACU69349.1"
FT                   /translation="MPLSGDGQQTQGQIGARLQEVRTRRGLTQRALAEPGYTAAYVSTL
FT                   EAGKARASEAALRYFAERLAISYEELATGVPAGLRAEIRDGLAEANAAMDAGRAAEAEA
FT                   LLAALLERAAGNDVPDLAADVRVALGAFLLRRGDLAAGREQFEQAEALLADRPLVARVR
FT                   AIRGRATAYYLEGDVRYSCYLLENTISELNGGGLPDPASLVLLYAAVIGPYLELGALER
FT                   ATKAATLALDLAPRVADPIAVATLHRSVARTLAAGGRFDEAEAALVKAQDVYQQWEIRA
FT                   ELAQCHWMRGYLYAQHERFADAETELRTAATMLRAADAVFYAVQVEVELADVRWRLGHT
FT                   DEAEHLLTRLLADLGPGHGAVHAAAAHRLLGLIRERADDPQTAERHYRQAIELQQDADV
FT                   AGDLADTSRLLGDLLDKQGRTREAVAAYRNGLTALARPGTTTLGAAPLPPPVISALDSV
FT                   HRAVHVVPGGGDSAAHE"
     MPLSGDGQQT QGQIGARLQE VRTRRGLTQR ALAEPGYTAA YVSTLEAGKA RASEAALRYF        60
     AERLAISYEE LATGVPAGLR AEIRDGLAEA NAAMDAGRAA EAEALLAALL ERAAGNDVPD       120
     LAADVRVALG AFLLRRGDLA AGREQFEQAE ALLADRPLVA RVRAIRGRAT AYYLEGDVRY       180
     SCYLLENTIS ELNGGGLPDP ASLVLLYAAV IGPYLELGAL ERATKAATLA LDLAPRVADP       240
     IAVATLHRSV ARTLAAGGRF DEAEAALVKA QDVYQQWEIR AELAQCHWMR GYLYAQHERF       300
     ADAETELRTA ATMLRAADAV FYAVQVEVEL ADVRWRLGHT DEAEHLLTRL LADLGPGHGA       360
     VHAAAAHRLL GLIRERADDP QTAERHYRQA IELQQDADVA GDLADTSRLL GDLLDKQGRT       420
     REAVAAYRNG LTALARPGTT TLGAAPLPPP VISALDSVHR AVHVVPGGGD SAAHE            475
//

If you have problems or comments...

PBIL Back to PBIL home page