(data stored in ACNUC7421 zone)

EMBL: CP001700.PE395

CP001700.PE395       Location/Qualifiers
FT   CDS             444478..445764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0398"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_7423 prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69350"
FT                   /db_xref="GOA:C7PVJ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69350.1"
FT                   /translation="MPPAIRQTDHLFTVPLHHDRPRGEQIELYAREVTADETLPWLVFL
FT                   QGGPGHRSPRPLPAALATGWLSRALQDYRVLLLDQRGTGRSTPATRQTLPSRGDARRQA
FT                   EYLTAFRADSIVRDAELVRRQLTGGAPWSVLGQSFGGFCTISYLSDAPEGLAEVFITGG
FT                   VPTLEGDADDVYRAAYPRMEDKNALLYHRYPQDVDIARSIAEFLREHETVLPDGTLLTV
FT                   EAFQSLGIMLGATDGVDRLHYLLEDPFCQTAHRTELSDRFQWQVQAALSFAERPLYALL
FT                   HEAIYAQGSGPTAWAASRVRKQFPRFDAERVLSETGTPLLFTGETIHPWHFRTDPALRP
FT                   LRAVADLLAGYEDWRPLYDTSVLAANTVPTFATVYTDDLYVDPKQSLTTADAIRALTVH
FT                   VSDDHEHDGLTASGTDVLDHLLGMARDAR"
     MPPAIRQTDH LFTVPLHHDR PRGEQIELYA REVTADETLP WLVFLQGGPG HRSPRPLPAA        60
     LATGWLSRAL QDYRVLLLDQ RGTGRSTPAT RQTLPSRGDA RRQAEYLTAF RADSIVRDAE       120
     LVRRQLTGGA PWSVLGQSFG GFCTISYLSD APEGLAEVFI TGGVPTLEGD ADDVYRAAYP       180
     RMEDKNALLY HRYPQDVDIA RSIAEFLREH ETVLPDGTLL TVEAFQSLGI MLGATDGVDR       240
     LHYLLEDPFC QTAHRTELSD RFQWQVQAAL SFAERPLYAL LHEAIYAQGS GPTAWAASRV       300
     RKQFPRFDAE RVLSETGTPL LFTGETIHPW HFRTDPALRP LRAVADLLAG YEDWRPLYDT       360
     SVLAANTVPT FATVYTDDLY VDPKQSLTTA DAIRALTVHV SDDHEHDGLT ASGTDVLDHL       420
     LGMARDAR                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page