(data stored in ACNUC7421 zone)

EMBL: CP001700.PE396

CP001700.PE396       Location/Qualifiers
FT   CDS             445809..446606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0399"
FT                   /product="protein of unknown function DUF239"
FT                   /note="PFAM: protein of unknown function DUF239; KEGG:
FT                   gvi:gll1344 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69351"
FT                   /db_xref="InterPro:IPR004314"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ5"
FT                   /inference="protein motif:PFAM:PF03080"
FT                   /protein_id="ACU69351.1"
FT                   /translation="MPAQALRALLGNLRTRIAAAAVSAAALGAVVVLPASSAHAAQCWY
FT                   GSCFSYVTGRQYTNTTGASVTMEQAAPRNVAADGHSLQELSLQTSGGTTVADTIEIGWT
FT                   VDPELNGDYQPHLFVFHWVDGQPTCYNACGFVQVSTTVRAGMAVTPGTTGVFALRYYQG
FT                   NWWAYYNNVAFGYFPGSAWKGAFTSAQIVSAFGEVASDSAPSCTQMGDGIYGSQSGASS
FT                   ISGYQLYGSTDRPALTVTATDPGSYNYGAVTGTSFNLGGPGAC"
     MPAQALRALL GNLRTRIAAA AVSAAALGAV VVLPASSAHA AQCWYGSCFS YVTGRQYTNT        60
     TGASVTMEQA APRNVAADGH SLQELSLQTS GGTTVADTIE IGWTVDPELN GDYQPHLFVF       120
     HWVDGQPTCY NACGFVQVST TVRAGMAVTP GTTGVFALRY YQGNWWAYYN NVAFGYFPGS       180
     AWKGAFTSAQ IVSAFGEVAS DSAPSCTQMG DGIYGSQSGA SSISGYQLYG STDRPALTVT       240
     ATDPGSYNYG AVTGTSFNLG GPGAC                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page