(data stored in ACNUC7421 zone)

EMBL: CP001700.PE397

CP001700.PE397       Location/Qualifiers
FT   CDS             446596..447435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0400"
FT                   /product="protein of unknown function DUF239"
FT                   /note="PFAM: protein of unknown function DUF239; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69352"
FT                   /db_xref="InterPro:IPR004314"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ6"
FT                   /inference="protein motif:PFAM:PF03080"
FT                   /protein_id="ACU69352.1"
FT                   /translation="MLAKVRVGLVSGLFSMSLLGSTAAAAVPAASAAVLAPRVPTVSAA
FT                   ATDSGPICWYGACYDYVSGHQWTDTTGVSVLMKVEKPVVNPAQTGEHSLQEIALQNTAR
FT                   TSTVEIGWTVDPELNGDNQPHLFVYHWVDGQESCYNACGFVQVSRAIKPGMALHPNEAA
FT                   NFATQNIHGDWWVFFRDEPVGYFPGSLWSGTYQTAQLVSVFGEVAENTADSPSCTQMGD
FT                   GRFGSSPAASWIRDYRIAGTKDAPNLAVSSTSPNHYDAGAVTPTSFKLGGPGTGACS"
     MLAKVRVGLV SGLFSMSLLG STAAAAVPAA SAAVLAPRVP TVSAAATDSG PICWYGACYD        60
     YVSGHQWTDT TGVSVLMKVE KPVVNPAQTG EHSLQEIALQ NTARTSTVEI GWTVDPELNG       120
     DNQPHLFVYH WVDGQESCYN ACGFVQVSRA IKPGMALHPN EAANFATQNI HGDWWVFFRD       180
     EPVGYFPGSL WSGTYQTAQL VSVFGEVAEN TADSPSCTQM GDGRFGSSPA ASWIRDYRIA       240
     GTKDAPNLAV SSTSPNHYDA GAVTPTSFKL GGPGTGACS                              279
//

If you have problems or comments...

PBIL Back to PBIL home page