(data stored in ACNUC7421 zone)

EMBL: CP001700.PE398

CP001700.PE398       Location/Qualifiers
FT   CDS             complement(447462..448199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0401"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kra:Krad_4255
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69353"
FT                   /db_xref="GOA:C7PVJ7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69353.1"
FT                   /translation="MTNAKTEMAKPQVAAPAAPRPLRRDAERNRQLIIDTAKTVFAARG
FT                   LDASLDEVAHEAGLGVGTVYRRFPNRDALIDALFDDMLASITRIVAESMALPRAWDGLV
FT                   HFMTAMLESQGRDKALRDLMLSRQKYLDQCELDREEVVRETVQPALYDIIGRAKAEGDL
FT                   RPDVVPADVGVLLISAVGVVDFTAPADPEVWRRHLAVLLDGLRARAAGDTTVLAPAPLD
FT                   DEQLDLCMSGWKYGTRETPRRRS"
     MTNAKTEMAK PQVAAPAAPR PLRRDAERNR QLIIDTAKTV FAARGLDASL DEVAHEAGLG        60
     VGTVYRRFPN RDALIDALFD DMLASITRIV AESMALPRAW DGLVHFMTAM LESQGRDKAL       120
     RDLMLSRQKY LDQCELDREE VVRETVQPAL YDIIGRAKAE GDLRPDVVPA DVGVLLISAV       180
     GVVDFTAPAD PEVWRRHLAV LLDGLRARAA GDTTVLAPAP LDDEQLDLCM SGWKYGTRET       240
     PRRRS                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page