(data stored in ACNUC7421 zone)

EMBL: CP001700.PE399

CP001700.PE399       Location/Qualifiers
FT   CDS             448361..449890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0402"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_7490 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69354"
FT                   /db_xref="GOA:C7PVJ8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69354.1"
FT                   /translation="MADLRTTGAEAQTADAAPADHTDHTDPHHARRWFILGIIGLAQLM
FT                   IVLDVTIVNIALPDAQKALGFSNGDRQWIVTAYSLAFGSLLLLFGRVSDVIGRRAMFLI
FT                   GLVGFAAASALGGAAPNFEILVLARALQGVAGAMLAPAALSLLSTTFTEAKERATAFAV
FT                   FGGIAGSGAAIGMLLGGVLTEFLNWRWTLFVNVGISVIAIAGAAVLIPRHARSADRPSL
FT                   DIPGTVLVSAGLFGIVYGFANAESHPWSAPGTWGFLVAGLVLLGAFTFWQTRTKHPLLP
FT                   LRVILERNRGGSYLAMFLTGIGMFGVFLFLNYYLQEILRYSPVMTGVAFLPMVAALMIT
FT                   ATISTTQLYPRVGAKILVFAGMLLAGAGMVWLTGISLTSSYAANILGPTVVVGIGMGAI
FT                   FAPAMNAATSGVEAGDAGVASAMVNTAQQIGGSIGTALLNSLAASALTSYLVGKNATNP
FT                   VVQANAAIHSYVVAFWWAAAIFGVGAIICGLILKSGKPDPADPDAAPAIHA"
     MADLRTTGAE AQTADAAPAD HTDHTDPHHA RRWFILGIIG LAQLMIVLDV TIVNIALPDA        60
     QKALGFSNGD RQWIVTAYSL AFGSLLLLFG RVSDVIGRRA MFLIGLVGFA AASALGGAAP       120
     NFEILVLARA LQGVAGAMLA PAALSLLSTT FTEAKERATA FAVFGGIAGS GAAIGMLLGG       180
     VLTEFLNWRW TLFVNVGISV IAIAGAAVLI PRHARSADRP SLDIPGTVLV SAGLFGIVYG       240
     FANAESHPWS APGTWGFLVA GLVLLGAFTF WQTRTKHPLL PLRVILERNR GGSYLAMFLT       300
     GIGMFGVFLF LNYYLQEILR YSPVMTGVAF LPMVAALMIT ATISTTQLYP RVGAKILVFA       360
     GMLLAGAGMV WLTGISLTSS YAANILGPTV VVGIGMGAIF APAMNAATSG VEAGDAGVAS       420
     AMVNTAQQIG GSIGTALLNS LAASALTSYL VGKNATNPVV QANAAIHSYV VAFWWAAAIF       480
     GVGAIICGLI LKSGKPDPAD PDAAPAIHA                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page