(data stored in ACNUC7421 zone)

EMBL: CP001700.PE4

CP001700.PE4         Location/Qualifiers
FT   CDS             4998..6143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sma:SAV_4319 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68959"
FT                   /db_xref="GOA:C7QFM0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACU68959.1"
FT                   /translation="MRVTHLSLADFRSYASLDVALGGGVTAFVGPNGQGKTNLVEAIGY
FT                   IATLDSHRVATDQPLVRFGAPRAIVRANVEREGRTQLVEIELNPGGANRARLNRNPVPR
FT                   PREVLGVLRTVLFAPEDLALVKGDPGERRRFLDELLVARWPRFAGVRADYDRVLKQRNT
FT                   LLRTAAMARRNKASGPNISTLDAWDHHLALAGAELVAARLALISALSPLVDKCYVEIAE
FT                   GGQTRIGYRSTISAEPDPTAAALTEQFMTALGEARANELDRGITLVGPHRDEMVLELTS
FT                   SSGDNMPARGYASHGESWSYALALRLAAYDLLRSDGSDGGEPVLILDDVFAELDAKRRR
FT                   RLAERVSGADQVLITAAVDADVPEQLIGQKFTVADGQVSAA"
     MRVTHLSLAD FRSYASLDVA LGGGVTAFVG PNGQGKTNLV EAIGYIATLD SHRVATDQPL        60
     VRFGAPRAIV RANVEREGRT QLVEIELNPG GANRARLNRN PVPRPREVLG VLRTVLFAPE       120
     DLALVKGDPG ERRRFLDELL VARWPRFAGV RADYDRVLKQ RNTLLRTAAM ARRNKASGPN       180
     ISTLDAWDHH LALAGAELVA ARLALISALS PLVDKCYVEI AEGGQTRIGY RSTISAEPDP       240
     TAAALTEQFM TALGEARANE LDRGITLVGP HRDEMVLELT SSSGDNMPAR GYASHGESWS       300
     YALALRLAAY DLLRSDGSDG GEPVLILDDV FAELDAKRRR RLAERVSGAD QVLITAAVDA       360
     DVPEQLIGQK FTVADGQVSA A                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page