(data stored in ACNUC7421 zone)

EMBL: CP001700.PE400

CP001700.PE400       Location/Qualifiers
FT   CDS             complement(449980..450621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0403"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3956
FT                   TetR family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69355"
FT                   /db_xref="GOA:C7PVJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVJ9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69355.1"
FT                   /translation="MPSTLSTDDREVEGTLDFVRLTDMAPARTLRADAARNREKLLSAA
FT                   TRLFAERGLDVPMEHIARTAGVSIGTLYAHFPTRVALFEAIFPTRLAALQELGRKALAE
FT                   PDAWQAFVGYLQDVFAMHAEDHGLNEVLARDIPDAAGVVQSCRQGAGHAAELIDRAHAD
FT                   GRLRADFTITDMSTLTRAMTRVIRDSINGGTDEWRRFLGIYIDGLRAENP"
     MPSTLSTDDR EVEGTLDFVR LTDMAPARTL RADAARNREK LLSAATRLFA ERGLDVPMEH        60
     IARTAGVSIG TLYAHFPTRV ALFEAIFPTR LAALQELGRK ALAEPDAWQA FVGYLQDVFA       120
     MHAEDHGLNE VLARDIPDAA GVVQSCRQGA GHAAELIDRA HADGRLRADF TITDMSTLTR       180
     AMTRVIRDSI NGGTDEWRRF LGIYIDGLRA ENP                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page