(data stored in ACNUC7421 zone)

EMBL: CP001700.PE401

CP001700.PE401       Location/Qualifiers
FT   CDS             450664..451374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0404"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: fal:FRAAL2466 putative short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69356"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69356.1"
FT                   /translation="MPTAVVIGVGPGLGMSIARRFGGAGHSVALVSRSDARHADYLAEL
FT                   ASAGIESEAFVADVNDREQVGSVVDAIEAKHGIDVLYYGPGASDVSQPAPITETTADEV
FT                   RASMGVVYAAVDIVGRVLPGMMARGRGGLLFAGGLSAVVPVPSLGALAVTSAALRNYAL
FT                   TLNAGLADTGVYAGTLIIGGLIERGDIHGFVVAHPEMFGHVPLRTLNPDDIAAAAWEMY
FT                   AARDRAEETFSVLS"
     MPTAVVIGVG PGLGMSIARR FGGAGHSVAL VSRSDARHAD YLAELASAGI ESEAFVADVN        60
     DREQVGSVVD AIEAKHGIDV LYYGPGASDV SQPAPITETT ADEVRASMGV VYAAVDIVGR       120
     VLPGMMARGR GGLLFAGGLS AVVPVPSLGA LAVTSAALRN YALTLNAGLA DTGVYAGTLI       180
     IGGLIERGDI HGFVVAHPEM FGHVPLRTLN PDDIAAAAWE MYAARDRAEE TFSVLS           236
//

If you have problems or comments...

PBIL Back to PBIL home page