(data stored in ACNUC7421 zone)

EMBL: CP001700.PE402

CP001700.PE402       Location/Qualifiers
FT   CDS             complement(451736..452164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0405"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="KEGG: sen:SACE_3470 dual specificity protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69357"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK1"
FT                   /inference="similar to AA sequence:KEGG:SACE_3470"
FT                   /protein_id="ACU69357.1"
FT                   /translation="MAELWDPAADGVLHLPSGRLIRGRGLSRPMPDGPAPSFAVYLLGK
FT                   QPPDVSWESRWVRWPDFRLPADRAAARECFVEAWQRCETERVEVACAGGRGRTGTALAC
FT                   IAVLDGVAPDAAVAYVREHYSPHAVETPWQRRFVAAFR"
     MAELWDPAAD GVLHLPSGRL IRGRGLSRPM PDGPAPSFAV YLLGKQPPDV SWESRWVRWP        60
     DFRLPADRAA ARECFVEAWQ RCETERVEVA CAGGRGRTGT ALACIAVLDG VAPDAAVAYV       120
     REHYSPHAVE TPWQRRFVAA FR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page