(data stored in ACNUC7421 zone)

EMBL: CP001700.PE403

CP001700.PE403       Location/Qualifiers
FT   CDS             complement(452188..452937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0406"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: gdj:Gdia_2872
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69358"
FT                   /db_xref="GOA:C7PVK2"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK2"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACU69358.1"
FT                   /translation="MSASILWEEPTGQGWTQVGELTTALVLSSAIGLEREIRQKAAGLR
FT                   TYTIIGLGAALFMLVSKYGFTDVLRPGLVQLDPSRVAAQIVSGLGFIGGGVIFMRRDSV
FT                   RGLTTAAAMWLTAGVGAAAGAGLGLLALLTTVAYFVVCYGLRPLTHWMPALRTPPVTYR
FT                   IEYQDGRGLLRTILDICTGAGFFVASFSGTGHDERDAQREPGAHPHTVEVVLTLHGRGN
FT                   ANALTEQLVDTSGIVAVAYNHEDDEFT"
     MSASILWEEP TGQGWTQVGE LTTALVLSSA IGLEREIRQK AAGLRTYTII GLGAALFMLV        60
     SKYGFTDVLR PGLVQLDPSR VAAQIVSGLG FIGGGVIFMR RDSVRGLTTA AAMWLTAGVG       120
     AAAGAGLGLL ALLTTVAYFV VCYGLRPLTH WMPALRTPPV TYRIEYQDGR GLLRTILDIC       180
     TGAGFFVASF SGTGHDERDA QREPGAHPHT VEVVLTLHGR GNANALTEQL VDTSGIVAVA       240
     YNHEDDEFT                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page