(data stored in ACNUC7421 zone)

EMBL: CP001700.PE404

CP001700.PE404       Location/Qualifiers
FT   CDS             453076..453852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fre:Franean1_1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69359"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK3"
FT                   /inference="similar to AA sequence:KEGG:Franean1_1635"
FT                   /protein_id="ACU69359.1"
FT                   /translation="MKALRKPERHAARQAWRMPGADLDRMFTLVRAVGQVELKFTVADA
FT                   SFDAVRGLLGVGVERVRNVYYLDTPDLTLRRHGVLARVRGGQRPNDSVVKLRPIDPGRV
FT                   PTAMLRCEDFTVEVDVTPDSFICSGALKQRLPGNAVERAVAARTPLRTLFSEDQIALLD
FT                   SRLSGRLTIDDLDPLGPVEVHRTRPRDGEPGRGLELQEWLYPDGSLLLEVSTRCTATDL
FT                   LQTAIQAKALLDEHGIQQAGPCPTKADTTLDYFTRQ"
     MKALRKPERH AARQAWRMPG ADLDRMFTLV RAVGQVELKF TVADASFDAV RGLLGVGVER        60
     VRNVYYLDTP DLTLRRHGVL ARVRGGQRPN DSVVKLRPID PGRVPTAMLR CEDFTVEVDV       120
     TPDSFICSGA LKQRLPGNAV ERAVAARTPL RTLFSEDQIA LLDSRLSGRL TIDDLDPLGP       180
     VEVHRTRPRD GEPGRGLELQ EWLYPDGSLL LEVSTRCTAT DLLQTAIQAK ALLDEHGIQQ       240
     AGPCPTKADT TLDYFTRQ                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page