(data stored in ACNUC7421 zone)

EMBL: CP001700.PE405

CP001700.PE405       Location/Qualifiers
FT   CDS             complement(454259..455722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0408"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_6391 drug/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69360"
FT                   /db_xref="GOA:C7PVK4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69360.1"
FT                   /translation="MPQTDSLARDAERVGSGAEARFDSDARSGSGSGSSSGSARSVGSP
FT                   KLTLFAALLGFVMIALDASAVNVALPAVGRGLGGSTAGLQWIVDAYTLMFAALLLSAGA
FT                   FSDRLGASRLYGGGAAAFTLASVACGLAPSLGFLIGARLVQGSAAALMLPSSLALVRQA
FT                   FPDASARAAAIAQWTMAGAASTAVGPVLGGALTSSVSWRSIFFLNLPVGLVILGALRRT
FT                   ERSVRRPAPLDLPGQLTAIVGLAALTYGVISGGASGFGRPQAWASVLLALVSFGAFGVV
FT                   EHRATEPMLPLGLLRDRVVAVCLAVGFVVNAAYYGLIFVFGLFAQDILGRSAVGAGLVF
FT                   MPTAILCTITNLFSARAAARWGARTPVLVGQLACAAGLLVLLLVNTHTSALELALLLLP
FT                   LAGGLGFAVPSLTAMMLSGIAPERAGLAGGVLNSFRQTGGALAVAGFGALVAQHGGFVT
FT                   GLHVSLLISVALLAVTTLGTLALPKVGRR"
     MPQTDSLARD AERVGSGAEA RFDSDARSGS GSGSSSGSAR SVGSPKLTLF AALLGFVMIA        60
     LDASAVNVAL PAVGRGLGGS TAGLQWIVDA YTLMFAALLL SAGAFSDRLG ASRLYGGGAA       120
     AFTLASVACG LAPSLGFLIG ARLVQGSAAA LMLPSSLALV RQAFPDASAR AAAIAQWTMA       180
     GAASTAVGPV LGGALTSSVS WRSIFFLNLP VGLVILGALR RTERSVRRPA PLDLPGQLTA       240
     IVGLAALTYG VISGGASGFG RPQAWASVLL ALVSFGAFGV VEHRATEPML PLGLLRDRVV       300
     AVCLAVGFVV NAAYYGLIFV FGLFAQDILG RSAVGAGLVF MPTAILCTIT NLFSARAAAR       360
     WGARTPVLVG QLACAAGLLV LLLVNTHTSA LELALLLLPL AGGLGFAVPS LTAMMLSGIA       420
     PERAGLAGGV LNSFRQTGGA LAVAGFGALV AQHGGFVTGL HVSLLISVAL LAVTTLGTLA       480
     LPKVGRR                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page