(data stored in ACNUC7421 zone)

EMBL: CP001700.PE406

CP001700.PE406       Location/Qualifiers
FT   CDS             455920..456831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0409"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: art:Arth_0445
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69361"
FT                   /db_xref="GOA:C7PVK5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69361.1"
FT                   /translation="MTEQQPELGRFLRARRAGVAPADLGLPLGTGTRRTPGLRREELAA
FT                   LAGVSIDYYIRLERGKETRPSPAVVDALGRALRLDPEELAYLRELAAQAARGGAPTRQR
FT                   PAASRAVRPTLRRLLETVRPCPAYVLSRTNDVLAANPGGLFLTPGMVDWPEKKRNTIRY
FT                   TFLHPQARTLWPDWDIKARACVAHLRAVAGTDPDDPELAAIVGELAVKSPEFSHMWERY
FT                   DVRRVGNGQKTFLHPIVGTMTLCHEVMEINHTGGGRIVVYSAEPGTPDHDAMVLLDMEA
FT                   ATALASRSNASGAVSVDADRDG"
     MTEQQPELGR FLRARRAGVA PADLGLPLGT GTRRTPGLRR EELAALAGVS IDYYIRLERG        60
     KETRPSPAVV DALGRALRLD PEELAYLREL AAQAARGGAP TRQRPAASRA VRPTLRRLLE       120
     TVRPCPAYVL SRTNDVLAAN PGGLFLTPGM VDWPEKKRNT IRYTFLHPQA RTLWPDWDIK       180
     ARACVAHLRA VAGTDPDDPE LAAIVGELAV KSPEFSHMWE RYDVRRVGNG QKTFLHPIVG       240
     TMTLCHEVME INHTGGGRIV VYSAEPGTPD HDAMVLLDME AATALASRSN ASGAVSVDAD       300
     RDG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page