(data stored in ACNUC7421 zone)

EMBL: CP001700.PE407

CP001700.PE407       Location/Qualifiers
FT   CDS             456966..458864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA2079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69362"
FT                   /db_xref="GOA:C7PVK6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69362.1"
FT                   /translation="MSAGTAVPDAAESVGELKPSRRSRRSAPDFASSLLRRDVFGVRLG
FT                   VLLLILPVILAGLGMQLTSRQGWNHPPDSRYYVAMMARDVGYSWSHSIHAELRVQPDNH
FT                   LSPWYFADNDPTWQMVRTRLLYPVLSVPFIWMWGLSGGSMAVPVLGTVLFLWATARLLQ
FT                   RLYGPAIAVIVAGGFSLTVPVNGFTWAGTDTLALGLAAVLVLNLPIERRIGKANLVWIG
FT                   AASIFIALTRQVGVLAPAMAGAGWLWLLVRERQWRNRWLGSLIVTAATTFLFQVLSMTL
FT                   APANTAGVIGHGETSYWGIFREFVHYLRIVTEEACTYMWHNDRMLYALFIAAGISVLAR
FT                   FKSDATAVFVGAVGATYVITAGVGFSGFMRYEMVMFPAAAVAAGQLVQLALGDHVRQPV
FT                   GAVAELEPAPTRTRTWFSDRFAALALTKPGRFLGLNLQRQDRWKPQLLFNSLVLAIVIG
FT                   VSLDGSWSSTVNAPASPSYAAAQGGSGYAVPPLAKPSADQTLRIMFAQAIGIAHGSAQL
FT                   QGALDWTHAMQYRPMAPDQPGWPNRAKDGTAVVNPNSMGMDIDMSEAYGRGLSLNSTVK
FT                   PDSVKILSRQVSEYGEDVVFTVEDTSGKVHQGTATTLYPIWHKNDPATVTALVFDA"
     MSAGTAVPDA AESVGELKPS RRSRRSAPDF ASSLLRRDVF GVRLGVLLLI LPVILAGLGM        60
     QLTSRQGWNH PPDSRYYVAM MARDVGYSWS HSIHAELRVQ PDNHLSPWYF ADNDPTWQMV       120
     RTRLLYPVLS VPFIWMWGLS GGSMAVPVLG TVLFLWATAR LLQRLYGPAI AVIVAGGFSL       180
     TVPVNGFTWA GTDTLALGLA AVLVLNLPIE RRIGKANLVW IGAASIFIAL TRQVGVLAPA       240
     MAGAGWLWLL VRERQWRNRW LGSLIVTAAT TFLFQVLSMT LAPANTAGVI GHGETSYWGI       300
     FREFVHYLRI VTEEACTYMW HNDRMLYALF IAAGISVLAR FKSDATAVFV GAVGATYVIT       360
     AGVGFSGFMR YEMVMFPAAA VAAGQLVQLA LGDHVRQPVG AVAELEPAPT RTRTWFSDRF       420
     AALALTKPGR FLGLNLQRQD RWKPQLLFNS LVLAIVIGVS LDGSWSSTVN APASPSYAAA       480
     QGGSGYAVPP LAKPSADQTL RIMFAQAIGI AHGSAQLQGA LDWTHAMQYR PMAPDQPGWP       540
     NRAKDGTAVV NPNSMGMDID MSEAYGRGLS LNSTVKPDSV KILSRQVSEY GEDVVFTVED       600
     TSGKVHQGTA TTLYPIWHKN DPATVTALVF DA                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page