(data stored in ACNUC7421 zone)

EMBL: CP001700.PE408

CP001700.PE408       Location/Qualifiers
FT   CDS             complement(458870..459403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_4855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69363"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK7"
FT                   /inference="similar to AA sequence:KEGG:SACE_4855"
FT                   /protein_id="ACU69363.1"
FT                   /translation="MHELKALLREYDRARAYTDDLWTDLTPDEVTWRPHEESSAIGWHL
FT                   GHQAHVAHFMIRNLTAAEPSPDPELDELMDSANPEKFRGALPTVERLTTFRNTVAQRVH
FT                   ARIGAIADGQVGAPSQMTIVGSYLLVALINHEYQHDQWIGEVRAQNLGHALPADPTADG
FT                   LRRVDGYLVLEPLG"
     MHELKALLRE YDRARAYTDD LWTDLTPDEV TWRPHEESSA IGWHLGHQAH VAHFMIRNLT        60
     AAEPSPDPEL DELMDSANPE KFRGALPTVE RLTTFRNTVA QRVHARIGAI ADGQVGAPSQ       120
     MTIVGSYLLV ALINHEYQHD QWIGEVRAQN LGHALPADPT ADGLRRVDGY LVLEPLG          177
//

If you have problems or comments...

PBIL Back to PBIL home page