(data stored in ACNUC7421 zone)

EMBL: CP001700.PE409

CP001700.PE409       Location/Qualifiers
FT   CDS             complement(459406..460905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0412"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_7490 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69364"
FT                   /db_xref="GOA:C7PVK8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69364.1"
FT                   /translation="MSHLQTTSLGPNAAHDPHDPHGEHAPQHARRWWILAVICLAQLMD
FT                   VLDVTIVNIALPDAQKSLDFSVGDRQWIVTAYSLAFGSLLLFSGRVSDLVGRRRMFLVG
FT                   LVAFAAASALGGAAPDFGVLVTARAVQGAAGAMLAPAALSLLSTTFTEPKERAKAFAVF
FT                   GGVSGSGAAIGMLLGGVLTEFLNWRFTLYVNVAIAVVAFIGAATLIQRRNETQSEIGER
FT                   PKLDLPGTILVSAALFGIVYGFADVESHAWTAPSTWVSLTSGVVLLGVFAWWQRQAANP
FT                   LLPLRIVLDRTRGGSILAIFLGSIGLFGAFLFLNFYLQGVLHYSPLMTGVAFLPMVVTL
FT                   VIAGGICTTQLYPRFGAKLPVTAGMLIAAAAMVLLTDIGPHSTYAGTVLGPLLVFGLGI
FT                   GATIAPAMSAGTADVEPRDAGIASATVNTAQQIGGSIGTALLNSLAASALGRYLVGKDA
FT                   ASHAVQTDAAIHSYSVAFWATGAIFAGGAVVCGLVLRRGKP"
     MSHLQTTSLG PNAAHDPHDP HGEHAPQHAR RWWILAVICL AQLMDVLDVT IVNIALPDAQ        60
     KSLDFSVGDR QWIVTAYSLA FGSLLLFSGR VSDLVGRRRM FLVGLVAFAA ASALGGAAPD       120
     FGVLVTARAV QGAAGAMLAP AALSLLSTTF TEPKERAKAF AVFGGVSGSG AAIGMLLGGV       180
     LTEFLNWRFT LYVNVAIAVV AFIGAATLIQ RRNETQSEIG ERPKLDLPGT ILVSAALFGI       240
     VYGFADVESH AWTAPSTWVS LTSGVVLLGV FAWWQRQAAN PLLPLRIVLD RTRGGSILAI       300
     FLGSIGLFGA FLFLNFYLQG VLHYSPLMTG VAFLPMVVTL VIAGGICTTQ LYPRFGAKLP       360
     VTAGMLIAAA AMVLLTDIGP HSTYAGTVLG PLLVFGLGIG ATIAPAMSAG TADVEPRDAG       420
     IASATVNTAQ QIGGSIGTAL LNSLAASALG RYLVGKDAAS HAVQTDAAIH SYSVAFWATG       480
     AIFAGGAVVC GLVLRRGKP                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page