(data stored in ACNUC7421 zone)

EMBL: CP001700.PE41

CP001700.PE41        Location/Qualifiers
FT   CDS             complement(43506..44222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0041"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: kra:Krad_0027 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68996"
FT                   /db_xref="GOA:C7QFQ7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ7"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU68996.1"
FT                   /translation="MWAESARTAIRSVGEILITLGLVLFLFCAYQLFYTNVVADEAMKS
FT                   EVSDLHKLWDAPVARAAAPRAANAFDTADSHGTAGAAFAILHIPRLGDKSIPVLQGTTL
FT                   DLLGRGVGHYKDSAMPGRTGNFAVAGHRKTHGEPFRYLDEMRDGDLIVVETADSWYTYR
FT                   EDRDPFIVDPTDLGVVAPVPDHPGATPSRKLITLTTCNPWWASTQRMIVTGELIAQQPR
FT                   SAGEPPAMTVNAPKFQ"
     MWAESARTAI RSVGEILITL GLVLFLFCAY QLFYTNVVAD EAMKSEVSDL HKLWDAPVAR        60
     AAAPRAANAF DTADSHGTAG AAFAILHIPR LGDKSIPVLQ GTTLDLLGRG VGHYKDSAMP       120
     GRTGNFAVAG HRKTHGEPFR YLDEMRDGDL IVVETADSWY TYREDRDPFI VDPTDLGVVA       180
     PVPDHPGATP SRKLITLTTC NPWWASTQRM IVTGELIAQQ PRSAGEPPAM TVNAPKFQ         238
//

If you have problems or comments...

PBIL Back to PBIL home page