(data stored in ACNUC7421 zone)

EMBL: CP001700.PE410

CP001700.PE410       Location/Qualifiers
FT   CDS             complement(460925..461656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0413"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: amr:AM1_3890 oxidoreductase, short
FT                   chain dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69365"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVK9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69365.1"
FT                   /translation="MTVKTALITGTSRAAGLGFAVARELAEQGFHVILTARDRAAAEPL
FT                   AEQLRLDGHAATALRLDLSDRASMDAVAKHVAETFGHLDVLVNNASGMPDFQVLSALEA
FT                   DMDTVRAALEVSVIGPWGLVEAVLPLLKAAPAARVVNVSSLSAQQIATGLNLGAPLRSP
FT                   AYSMAKYMLNALTSVLARALADTPILVNAVDPGNTATHPERGDDDSDRPAAESARDIVR
FT                   AATFGSDGPSGVLFSGGQPVA"
     MTVKTALITG TSRAAGLGFA VARELAEQGF HVILTARDRA AAEPLAEQLR LDGHAATALR        60
     LDLSDRASMD AVAKHVAETF GHLDVLVNNA SGMPDFQVLS ALEADMDTVR AALEVSVIGP       120
     WGLVEAVLPL LKAAPAARVV NVSSLSAQQI ATGLNLGAPL RSPAYSMAKY MLNALTSVLA       180
     RALADTPILV NAVDPGNTAT HPERGDDDSD RPAAESARDI VRAATFGSDG PSGVLFSGGQ       240
     PVA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page