(data stored in ACNUC7421 zone)

EMBL: CP001700.PE411

CP001700.PE411       Location/Qualifiers
FT   CDS             461750..462451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0414"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Tetracyclin repressor domain protein;
FT                   regulatory protein TetR; KEGG: sma:SAV_775 TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69366"
FT                   /db_xref="GOA:C7PVL0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL0"
FT                   /inference="protein motif:PFAM:PF02909"
FT                   /protein_id="ACU69366.1"
FT                   /translation="MAAEPAEPAEPAEPAPRKTPITLERITDAALQVVATEGYDALTIR
FT                   RVTNVLGTGPSSLYAHIATKTDIDDLLIGRLCSEITLPDPDPATWQHQLRDVYAQLRDQ
FT                   YLKYPGISKAALATVSANPETLRVSEGIFAILLSAGIDPQTAAWTMDAITLYVAAYALE
FT                   LSLVHHRRKDPTTPWLLSHEALTAHLTSLPEATFPQTRRHAAALTSGTGHQRFDFALTL
FT                   LIDNLTSQTKS"
     MAAEPAEPAE PAEPAPRKTP ITLERITDAA LQVVATEGYD ALTIRRVTNV LGTGPSSLYA        60
     HIATKTDIDD LLIGRLCSEI TLPDPDPATW QHQLRDVYAQ LRDQYLKYPG ISKAALATVS       120
     ANPETLRVSE GIFAILLSAG IDPQTAAWTM DAITLYVAAY ALELSLVHHR RKDPTTPWLL       180
     SHEALTAHLT SLPEATFPQT RRHAAALTSG TGHQRFDFAL TLLIDNLTSQ TKS              233
//

If you have problems or comments...

PBIL Back to PBIL home page