(data stored in ACNUC7421 zone)

EMBL: CP001700.PE412

CP001700.PE412       Location/Qualifiers
FT   CDS             462581..464764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0415"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases; helicase domain protein; KEGG:
FT                   sgr:SGR_1018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69367"
FT                   /db_xref="GOA:C7PVL1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL1"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACU69367.1"
FT                   /translation="MPRGQAFTNSSGVKSVLHAAADAETAIREMHEGDERRHQAVRDAY
FT                   QASHAVAVLGRLRSISIERLRDVTGARLPVTKLEEAGYKSIADLLEATPEQLQQVPGIG
FT                   TKGAERTVDAARRIADAAMSGTHVTADMDLRVADAATLLAALYRVQTADRVLLKVREPA
FT                   KRIGGALTSLADTAKPLSSRMRRVITGRAKREEAQGAVDRLEGLLGDPATNQDLERIKA
FT                   ANEKLRGVKPPRPSVVRNDFEKRSADYFSTLSRIAGARANGEAARGFLPTSLADRIGVQ
FT                   QLDETHLRVSLRAYQAFGVRFALAQKRVVIGDEMGCGKTVEAIATLAHLRAEGAKHFLV
FT                   VVPASVLINWLREVRAHSSLRPYRLHGPQGEAALKAWLSGGGVGITTFEALPNLELPPR
FT                   TRISMLVVDEAHYVKNPNTMRSRAVRAWTDRVERVMFLTGTPMENRVEEFRNLVGYLQP
FT                   DLVDSVGEIDAVAGSEAFRKAVAPAYLRRNQEDVLSELPEMVKIEEWEEFGPEEEAMYR
FT                   DAVAARNFMAMRRAAYATGDPATSAKLRRLVEIVDEAEANSRKVVVFSYFRDVLDTVCR
FT                   ALGDRASGPLTGSMQPQHRQELVDAFTAAKKHAVLVSQIQAGGVGLNMQAASVVILCEP
FT                   QVKPTLETQAIARAHRMGQIRRVQVHRLLVADSVDQRMLEILDAKSGLFDAYARRSETA
FT                   ETMPEAKDLSDASVRKQLIDAEQERLGLDKARS"
     MPRGQAFTNS SGVKSVLHAA ADAETAIREM HEGDERRHQA VRDAYQASHA VAVLGRLRSI        60
     SIERLRDVTG ARLPVTKLEE AGYKSIADLL EATPEQLQQV PGIGTKGAER TVDAARRIAD       120
     AAMSGTHVTA DMDLRVADAA TLLAALYRVQ TADRVLLKVR EPAKRIGGAL TSLADTAKPL       180
     SSRMRRVITG RAKREEAQGA VDRLEGLLGD PATNQDLERI KAANEKLRGV KPPRPSVVRN       240
     DFEKRSADYF STLSRIAGAR ANGEAARGFL PTSLADRIGV QQLDETHLRV SLRAYQAFGV       300
     RFALAQKRVV IGDEMGCGKT VEAIATLAHL RAEGAKHFLV VVPASVLINW LREVRAHSSL       360
     RPYRLHGPQG EAALKAWLSG GGVGITTFEA LPNLELPPRT RISMLVVDEA HYVKNPNTMR       420
     SRAVRAWTDR VERVMFLTGT PMENRVEEFR NLVGYLQPDL VDSVGEIDAV AGSEAFRKAV       480
     APAYLRRNQE DVLSELPEMV KIEEWEEFGP EEEAMYRDAV AARNFMAMRR AAYATGDPAT       540
     SAKLRRLVEI VDEAEANSRK VVVFSYFRDV LDTVCRALGD RASGPLTGSM QPQHRQELVD       600
     AFTAAKKHAV LVSQIQAGGV GLNMQAASVV ILCEPQVKPT LETQAIARAH RMGQIRRVQV       660
     HRLLVADSVD QRMLEILDAK SGLFDAYARR SETAETMPEA KDLSDASVRK QLIDAEQERL       720
     GLDKARS                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page