(data stored in ACNUC7421 zone)

EMBL: CP001700.PE413

CP001700.PE413       Location/Qualifiers
FT   CDS             464809..465810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_2039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69368"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL2"
FT                   /inference="similar to AA sequence:KEGG:SACE_2039"
FT                   /protein_id="ACU69368.1"
FT                   /translation="MEPARLGQLRRDLAHAVRMGPFSATLHLAIEASGMTLEQVRLELA
FT                   ARGAFVSMATLSYWRRGMSRPERPESLHAVELLEEVLALSTGALTGQLGPRRPRGRTAA
FT                   RRESGLDVVDAWDAHREYDHLLQGLDPAGRLELTRVSTLDRYSLGADRRELSLTTCQVL
FT                   RAEADDLSRMTVLYRTYDPPSPSPVLKALNGCRVGRVRIAQDSGFVAAELLFDRVLRRG
FT                   ETAVVDYELTGLSPSPPTETDFYQRFFPYATALYVLRVQFDPATVPARCVRYERRTETA
FT                   PDQGVREVWVGATGQAHVMATDVPPGVVGLRWDWGAGLHDLPSLGRGDPPAR"
     MEPARLGQLR RDLAHAVRMG PFSATLHLAI EASGMTLEQV RLELAARGAF VSMATLSYWR        60
     RGMSRPERPE SLHAVELLEE VLALSTGALT GQLGPRRPRG RTAARRESGL DVVDAWDAHR       120
     EYDHLLQGLD PAGRLELTRV STLDRYSLGA DRRELSLTTC QVLRAEADDL SRMTVLYRTY       180
     DPPSPSPVLK ALNGCRVGRV RIAQDSGFVA AELLFDRVLR RGETAVVDYE LTGLSPSPPT       240
     ETDFYQRFFP YATALYVLRV QFDPATVPAR CVRYERRTET APDQGVREVW VGATGQAHVM       300
     ATDVPPGVVG LRWDWGAGLH DLPSLGRGDP PAR                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page