(data stored in ACNUC7421 zone)

EMBL: CP001700.PE414

CP001700.PE414       Location/Qualifiers
FT   CDS             complement(465862..467640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0417"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; KEGG: bam:Bamb_0804
FT                   peptidase S8 and S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69369"
FT                   /db_xref="GOA:C7PVL3"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL3"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACU69369.1"
FT                   /translation="MRRILLAGVITSALSTVAAMAMVQPAEAAVSPQIVPASCASAPAG
FT                   HAHCNAVQLVPSGARPAAPTGFGPSDIQSAYNLGTNPGSGQTVAIVDAYDDPNAESDLR
FT                   TYRSQWGLSACTTANGCFSKVDQNGGTTYPSGDSGWGAEITLDLDAVSAACPGCHILLV
FT                   EATTNDDNDLGAAVDEAVRLGAKFVSNSYSDAESDFTTGMDAHYNHPGVMIAAATGDNG
FT                   TQSGSSAQFPATFPSVVAVGGTSLSQASNSRGWSESVWNKGGSGCSSLFAKPSYQQNVT
FT                   TNCAKRASADVSADANPNTGLAIYDSYGQSGWEEYGGTSLATPLISAMWAQAGAPASGD
FT                   SGVSYLYANEAKFNDVTSGSNGSCGTVICNAGTGWDGPTGVGTPNGVSGFASGTTPPPP
FT                   ANDFSVSVSPASGSVNPGSSATSTVGTKVASGSAVTVQLSASGLPSGASASFNPASVTA
FT                   GSSSTMTIATSASTPAGTYSVTVTGTAGSTTHTAAYSLTVNGTGGGGTVTVSNPGTQLW
FT                   FVGYQSQPLQIRASDSKNLALTFSATGLPPGLGISASGVISGTPTRAGTYQVTVKATDS
FT                   GGGSGSTTFGYQVYGF"
     MRRILLAGVI TSALSTVAAM AMVQPAEAAV SPQIVPASCA SAPAGHAHCN AVQLVPSGAR        60
     PAAPTGFGPS DIQSAYNLGT NPGSGQTVAI VDAYDDPNAE SDLRTYRSQW GLSACTTANG       120
     CFSKVDQNGG TTYPSGDSGW GAEITLDLDA VSAACPGCHI LLVEATTNDD NDLGAAVDEA       180
     VRLGAKFVSN SYSDAESDFT TGMDAHYNHP GVMIAAATGD NGTQSGSSAQ FPATFPSVVA       240
     VGGTSLSQAS NSRGWSESVW NKGGSGCSSL FAKPSYQQNV TTNCAKRASA DVSADANPNT       300
     GLAIYDSYGQ SGWEEYGGTS LATPLISAMW AQAGAPASGD SGVSYLYANE AKFNDVTSGS       360
     NGSCGTVICN AGTGWDGPTG VGTPNGVSGF ASGTTPPPPA NDFSVSVSPA SGSVNPGSSA       420
     TSTVGTKVAS GSAVTVQLSA SGLPSGASAS FNPASVTAGS SSTMTIATSA STPAGTYSVT       480
     VTGTAGSTTH TAAYSLTVNG TGGGGTVTVS NPGTQLWFVG YQSQPLQIRA SDSKNLALTF       540
     SATGLPPGLG ISASGVISGT PTRAGTYQVT VKATDSGGGS GSTTFGYQVY GF               592
//

If you have problems or comments...

PBIL Back to PBIL home page