(data stored in ACNUC7421 zone)

EMBL: CP001700.PE415

CP001700.PE415       Location/Qualifiers
FT   CDS             468043..469284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0418"
FT                   /product="protease-like protein"
FT                   /note="KEGG: bmv:BMASAVP1_A0748 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69370"
FT                   /db_xref="GOA:C7PVL4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL4"
FT                   /inference="protein motif:COG:COG4934"
FT                   /protein_id="ACU69370.1"
FT                   /translation="MRTNLRPAHRRAAISLAAAAVLGITAAAVATSANAAGAPAAKSAG
FT                   PAWSRACDAPAPGMAACDALHVTNVPEHIRALGVTPNATPSGFGPADLRSAYKLPANGG
FT                   AGQTVAIVDAYNDPNAAADMATYRSQFGLPACTVASGCFKQVSQTGTSTLPANNTGWAG
FT                   EISLDLDMVSAVAPNAHIILVEAKTASMANLGTAVNEAVKLGAKFVSNSYGGGESSADT
FT                   GYDTKYFQHSGVAITASSGDGGYGVEYPAASPYVTAVGGTALKKDSSARGWSESVWSTN
FT                   STEGAGSGCSAYEPKPTWQKDTGCSKRTVADVSAVADPATGVAVYQTYGGSGWAVYGGT
FT                   SVASPLIAAVYADAGTPKASVPAANIYSHTSALNDVTTGKTATCTPKYLCTAGTGFDGP
FT                   TGWGTPNGLAAFTG"
     MRTNLRPAHR RAAISLAAAA VLGITAAAVA TSANAAGAPA AKSAGPAWSR ACDAPAPGMA        60
     ACDALHVTNV PEHIRALGVT PNATPSGFGP ADLRSAYKLP ANGGAGQTVA IVDAYNDPNA       120
     AADMATYRSQ FGLPACTVAS GCFKQVSQTG TSTLPANNTG WAGEISLDLD MVSAVAPNAH       180
     IILVEAKTAS MANLGTAVNE AVKLGAKFVS NSYGGGESSA DTGYDTKYFQ HSGVAITASS       240
     GDGGYGVEYP AASPYVTAVG GTALKKDSSA RGWSESVWST NSTEGAGSGC SAYEPKPTWQ       300
     KDTGCSKRTV ADVSAVADPA TGVAVYQTYG GSGWAVYGGT SVASPLIAAV YADAGTPKAS       360
     VPAANIYSHT SALNDVTTGK TATCTPKYLC TAGTGFDGPT GWGTPNGLAA FTG              413
//

If you have problems or comments...

PBIL Back to PBIL home page