(data stored in ACNUC7421 zone)

EMBL: CP001700.PE416

CP001700.PE416       Location/Qualifiers
FT   CDS             469477..470052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0419"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sen:SACE_1454 RNA
FT                   polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69371"
FT                   /db_xref="GOA:C7PVL5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL5"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69371.1"
FT                   /translation="MPEFTEFAQARQAHMRRMAFLLCGNWHDAQDVTQIALMNLCRAWS
FT                   RARRADSIDAYAHRVVVRAYLSQRKKVLRQQARAVEYARASERVPGSAEESGEPELRMA
FT                   LLAALAQLPPRGRAVVVLRFWEDLSIEATAEALGCSTGNVKSQASRSLAKLREILGDSL
FT                   FDEGDGGGPRRAHVHAGVRPVWEVDGRA"
     MPEFTEFAQA RQAHMRRMAF LLCGNWHDAQ DVTQIALMNL CRAWSRARRA DSIDAYAHRV        60
     VVRAYLSQRK KVLRQQARAV EYARASERVP GSAEESGEPE LRMALLAALA QLPPRGRAVV       120
     VLRFWEDLSI EATAEALGCS TGNVKSQASR SLAKLREILG DSLFDEGDGG GPRRAHVHAG       180
     VRPVWEVDGR A                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page