(data stored in ACNUC7421 zone)

EMBL: CP001700.PE417

CP001700.PE417       Location/Qualifiers
FT   CDS             470049..471098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69372"
FT                   /db_xref="GOA:C7PVL6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69372.1"
FT                   /translation="MTENPGRLRALLDDTLTDEPPLLDLVPDAVTAAEQGRRRGRMMAG
FT                   GAAVAVLAVSVGAYAVADHGRSGTNGSPIVSPGISRSSTSAAPPVRLSHKSTLGIPGLF
FT                   DHPGTPQQECAKVNGPVMDSKAQLSSPAERNYCIQSLQTIRALLPDAVVVLNPFVDFNQ
FT                   PAWSAPLVQTPDGGTAPGFTQAYQQSAKNSAKTVYLAGTFAFRTANGEGSIIYTTTSPG
FT                   VKAKPQGGDLPLDDGTSGRIAHEDSGSIDVTGVTADGVWYRLEISGVGPVYGADGSTLE
FT                   PNLHTDGQGHSVFPDGYVAAGDSALHMHIPNPYTVTEVRQKIVDMGLGNVIHTMGVDPL
FT                   SDYPAPPAG"
     MTENPGRLRA LLDDTLTDEP PLLDLVPDAV TAAEQGRRRG RMMAGGAAVA VLAVSVGAYA        60
     VADHGRSGTN GSPIVSPGIS RSSTSAAPPV RLSHKSTLGI PGLFDHPGTP QQECAKVNGP       120
     VMDSKAQLSS PAERNYCIQS LQTIRALLPD AVVVLNPFVD FNQPAWSAPL VQTPDGGTAP       180
     GFTQAYQQSA KNSAKTVYLA GTFAFRTANG EGSIIYTTTS PGVKAKPQGG DLPLDDGTSG       240
     RIAHEDSGSI DVTGVTADGV WYRLEISGVG PVYGADGSTL EPNLHTDGQG HSVFPDGYVA       300
     AGDSALHMHI PNPYTVTEVR QKIVDMGLGN VIHTMGVDPL SDYPAPPAG                   349
//

If you have problems or comments...

PBIL Back to PBIL home page