(data stored in ACNUC7421 zone)

EMBL: CP001700.PE418

CP001700.PE418       Location/Qualifiers
FT   CDS             complement(471179..471757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0421"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   sco:SCO1356 iron sulphur protein (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69373"
FT                   /db_xref="GOA:C7PVL7"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL7"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACU69373.1"
FT                   /translation="MTTVDLAAATQTTDKHACLGHPEGTSRRTALLGIAVAAGAVCAGC
FT                   SSSKSSSASTSPSTSAAAGSTSAADSSSSSSAAGSSTGTASSSASSSGSSGAAGALAAT
FT                   SAVPVGGGTVLTDQKIVLTQPTAGTFKAFTAVCTHQGCVVGSVANGLIVCPCHGSAYHI
FT                   ADGSVANGPAPTALAEIAIKVSGGEITQA"
     MTTVDLAAAT QTTDKHACLG HPEGTSRRTA LLGIAVAAGA VCAGCSSSKS SSASTSPSTS        60
     AAAGSTSAAD SSSSSSAAGS STGTASSSAS SSGSSGAAGA LAATSAVPVG GGTVLTDQKI       120
     VLTQPTAGTF KAFTAVCTHQ GCVVGSVANG LIVCPCHGSA YHIADGSVAN GPAPTALAEI       180
     AIKVSGGEIT QA                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page