(data stored in ACNUC7421 zone)

EMBL: CP001700.PE42

CP001700.PE42        Location/Qualifiers
FT   CDS             complement(44241..45053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0042"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   sgr:SGR_3719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68997"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ8"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ACU68997.1"
FT                   /translation="MASGRDQLDEPESADGPEPAGGPAPRPRSRVAWHTGVVLVFALAG
FT                   ALFLTARDTADGQGDIRPDRGAQLSDVIRAQNTHNQQLTEQVAGQRADQDALTRGQSAD
FT                   ARVKAVQDQVDALAAPVALTPVSGSALAVTLNDAPPNAQPAAGAPTAQPDWLIIHQQDV
FT                   QAVVNALWAGGATGIQLMDQRLAPTSAVRCVGNTLLLQGRVYSPPYVITAVGDTAKLRS
FT                   SLLAAPAVQTYLEYVSAYGLGWDVKARDRVTLPGYTGPLDVSFASVAP"
     MASGRDQLDE PESADGPEPA GGPAPRPRSR VAWHTGVVLV FALAGALFLT ARDTADGQGD        60
     IRPDRGAQLS DVIRAQNTHN QQLTEQVAGQ RADQDALTRG QSADARVKAV QDQVDALAAP       120
     VALTPVSGSA LAVTLNDAPP NAQPAAGAPT AQPDWLIIHQ QDVQAVVNAL WAGGATGIQL       180
     MDQRLAPTSA VRCVGNTLLL QGRVYSPPYV ITAVGDTAKL RSSLLAAPAV QTYLEYVSAY       240
     GLGWDVKARD RVTLPGYTGP LDVSFASVAP                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page