(data stored in ACNUC7421 zone)

EMBL: CP001700.PE420

CP001700.PE420       Location/Qualifiers
FT   CDS             complement(473819..474556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_6625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69375"
FT                   /db_xref="GOA:C7PVL9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVL9"
FT                   /inference="similar to AA sequence:KEGG:SAV_6625"
FT                   /protein_id="ACU69375.1"
FT                   /translation="MTSMAGSTPERRRSWVRGRLRDGKVAREGGVQKGRVREGRVRRFT
FT                   VAERMVHRGTGVLMLLCVATAACLYIGPLAQAVGRRHLMVTVHEWSGILLPAPVLLGLL
FT                   SPAFRADLRRLNRFAPADRHWLRAVRRRLMEPPDRPAGKFNAGQKLYAGWIAGAVLVMM
FT                   FTGLLMWFTHLLPGISRTSSIFVHDILAWGIAVVLLAHMRKAYQDPESRRGMRTGYVDR
FT                   VWAKRNHSEWLAKDEPDGSHQQV"
     MTSMAGSTPE RRRSWVRGRL RDGKVAREGG VQKGRVREGR VRRFTVAERM VHRGTGVLML        60
     LCVATAACLY IGPLAQAVGR RHLMVTVHEW SGILLPAPVL LGLLSPAFRA DLRRLNRFAP       120
     ADRHWLRAVR RRLMEPPDRP AGKFNAGQKL YAGWIAGAVL VMMFTGLLMW FTHLLPGISR       180
     TSSIFVHDIL AWGIAVVLLA HMRKAYQDPE SRRGMRTGYV DRVWAKRNHS EWLAKDEPDG       240
     SHQQV                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page