(data stored in ACNUC7421 zone)

EMBL: CP001700.PE421

CP001700.PE421       Location/Qualifiers
FT   CDS             complement(474528..475229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0424"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   sma:SAV_6624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69376"
FT                   /db_xref="GOA:C7PVM0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM0"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACU69376.1"
FT                   /translation="MPDSEAENTPDGAPLARRTLFGVLGAGAAGLIAAPYLQAGWEKVL
FT                   AKASEDDPTGLSGLLPNPGGFRYYSVVGSVPRKDETNYELRIGGLVDRARSYTLADLRA
FT                   LPQTRIVHDVQCTDGWRVEKTPFEGVRLSDLLDDAGVAGNGKALRFTCFDGAYSESLTL
FT                   EQARRDDVLIALQMQDAPITHDHGGPVRLYVAPMYFYKSAKWLSGISVTDRVVPGYWEE
FT                   RGYDVDGWLDA"
     MPDSEAENTP DGAPLARRTL FGVLGAGAAG LIAAPYLQAG WEKVLAKASE DDPTGLSGLL        60
     PNPGGFRYYS VVGSVPRKDE TNYELRIGGL VDRARSYTLA DLRALPQTRI VHDVQCTDGW       120
     RVEKTPFEGV RLSDLLDDAG VAGNGKALRF TCFDGAYSES LTLEQARRDD VLIALQMQDA       180
     PITHDHGGPV RLYVAPMYFY KSAKWLSGIS VTDRVVPGYW EERGYDVDGW LDA              233
//

If you have problems or comments...

PBIL Back to PBIL home page