(data stored in ACNUC7421 zone)

EMBL: CP001700.PE422

CP001700.PE422       Location/Qualifiers
FT   CDS             475544..476416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0425"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   nca:Noca_3836 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69377"
FT                   /db_xref="GOA:C7PVM1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69377.1"
FT                   /translation="MTSLRLADGRNLEYLVAGPDGGTPLVFHHGTPFAAVLFEPMVEAA
FT                   TRHGLRFVVHSRPGYADSSPQPGRTIASVAEDVAALLAALDAERFLTVGWSGGGPHALA
FT                   CAALLPERCVAAATVAGVAPYRAEGLDWLDGMGAENIEEFAAAVSGAAPLTEFLSAQAA
FT                   GLANVQGADIAAALGELISEVDGRALSDAFADFTAAAFRKAVSAGIDGWHEDDLAFIGD
FT                   WGFDLAAIKTPVSVWQGDEDRMVPFAHGRWLAGALPGAAAQLLPNEGHLSLVLDRFDDV
FT                   VADLVKRLP"
     MTSLRLADGR NLEYLVAGPD GGTPLVFHHG TPFAAVLFEP MVEAATRHGL RFVVHSRPGY        60
     ADSSPQPGRT IASVAEDVAA LLAALDAERF LTVGWSGGGP HALACAALLP ERCVAAATVA       120
     GVAPYRAEGL DWLDGMGAEN IEEFAAAVSG AAPLTEFLSA QAAGLANVQG ADIAAALGEL       180
     ISEVDGRALS DAFADFTAAA FRKAVSAGID GWHEDDLAFI GDWGFDLAAI KTPVSVWQGD       240
     EDRMVPFAHG RWLAGALPGA AAQLLPNEGH LSLVLDRFDD VVADLVKRLP                  290
//

If you have problems or comments...

PBIL Back to PBIL home page