(data stored in ACNUC7421 zone)

EMBL: CP001700.PE424

CP001700.PE424       Location/Qualifiers
FT   CDS             477158..477562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0427"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3738 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69379"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM3"
FT                   /inference="similar to AA sequence:KEGG:SCO3738"
FT                   /protein_id="ACU69379.1"
FT                   /translation="MRTRSLLTTLACAAVMVGAGAESAFADATPTTQPSAVPTRSAAPS
FT                   VPPTTAPTATAMPSAVPSDSARTAAPATPPPTLPGRQVGAVPSGAPNTGEPVAASKGHG
FT                   EAEAVGASLALLLAGSGSVMVRRRKLKGRG"
     MRTRSLLTTL ACAAVMVGAG AESAFADATP TTQPSAVPTR SAAPSVPPTT APTATAMPSA        60
     VPSDSARTAA PATPPPTLPG RQVGAVPSGA PNTGEPVAAS KGHGEAEAVG ASLALLLAGS       120
     GSVMVRRRKL KGRG                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page