(data stored in ACNUC7421 zone)

EMBL: CP001700.PE425

CP001700.PE425       Location/Qualifiers
FT   CDS             477565..478272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0428"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   sma:SAV_92 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69380"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM4"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACU69380.1"
FT                   /translation="MRRAWTRGWPAVIAALLLASGCAAGSSTSAGGSGRNAGGTGTNPA
FT                   AATAGGPAGSQAGGTAGTPAGGTSGTSSAGNSTSAGAIARSDPVRLQIPAIGVDTSVMA
FT                   LGLAADGTVQVPPIEKDSPAGWYNGSPTPGQTGPSVILGHVTVGKYGDGVFLKLAQLKP
FT                   GAHVVVRLQDGASADFTVDSVRTVAKAQFPTQEVYGNVNRPELRLITCGGERTSDGYLD
FT                   NVLVFASLTGTAG"
     MRRAWTRGWP AVIAALLLAS GCAAGSSTSA GGSGRNAGGT GTNPAAATAG GPAGSQAGGT        60
     AGTPAGGTSG TSSAGNSTSA GAIARSDPVR LQIPAIGVDT SVMALGLAAD GTVQVPPIEK       120
     DSPAGWYNGS PTPGQTGPSV ILGHVTVGKY GDGVFLKLAQ LKPGAHVVVR LQDGASADFT       180
     VDSVRTVAKA QFPTQEVYGN VNRPELRLIT CGGERTSDGY LDNVLVFASL TGTAG            235
//

If you have problems or comments...

PBIL Back to PBIL home page