(data stored in ACNUC7421 zone)

EMBL: CP001700.PE426

CP001700.PE426       Location/Qualifiers
FT   CDS             478313..478825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0429"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; KEGG: sco:SCO3736 RNA polymerase ECF sigma
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69381"
FT                   /db_xref="GOA:C7PVM5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM5"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU69381.1"
FT                   /translation="MSRSKDSGEKSRAASDLFTDLYPGLAGWCRRLVDDDGTAHEIASE
FT                   AFTRLWGHWTSVREPRGFLYVTAANLVRDHWRKMDRERRAIRQVSAEVERAAHHDGADA
FT                   SVSVRMLVRSLPERLRTPVLLYYYADLPIREIAQLTRRKEGTVKSDLHAARELLRAGLG
FT                   GHLDHAH"
     MSRSKDSGEK SRAASDLFTD LYPGLAGWCR RLVDDDGTAH EIASEAFTRL WGHWTSVREP        60
     RGFLYVTAAN LVRDHWRKMD RERRAIRQVS AEVERAAHHD GADASVSVRM LVRSLPERLR       120
     TPVLLYYYAD LPIREIAQLT RRKEGTVKSD LHAARELLRA GLGGHLDHAH                  170
//

If you have problems or comments...

PBIL Back to PBIL home page