(data stored in ACNUC7421 zone)

EMBL: CP001700.PE427

CP001700.PE427       Location/Qualifiers
FT   CDS             478809..479513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_94 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69382"
FT                   /db_xref="GOA:C7PVM6"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69382.1"
FT                   /translation="MITLIEPADDDDDAVTGDQGGVGGVGGARGSGGDGDSDSDSFGYS
FT                   IEGDDGDGDELVVLLRPGVSVLAPPAGAFQRIRRRAARRRLARAAATVGAGAAMAAVAV
FT                   TVALWPSNSALGPPAPVSPVAPPVQRTSIPDAPATTPLTSSSPSPSPSSLPSSSPSPTP
FT                   QRPHAGPSDSAAPPTAPPSTAVRTAPTRVPTTRPATAATPSTPPRTEGSVTPEGSATPA
FT                   GRATPTCPSGCG"
     MITLIEPADD DDDAVTGDQG GVGGVGGARG SGGDGDSDSD SFGYSIEGDD GDGDELVVLL        60
     RPGVSVLAPP AGAFQRIRRR AARRRLARAA ATVGAGAAMA AVAVTVALWP SNSALGPPAP       120
     VSPVAPPVQR TSIPDAPATT PLTSSSPSPS PSSLPSSSPS PTPQRPHAGP SDSAAPPTAP       180
     PSTAVRTAPT RVPTTRPATA ATPSTPPRTE GSVTPEGSAT PAGRATPTCP SGCG             234
//

If you have problems or comments...

PBIL Back to PBIL home page