(data stored in ACNUC7421 zone)

EMBL: CP001700.PE428

CP001700.PE428       Location/Qualifiers
FT   CDS             479655..480716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0431"
FT                   /product="Carbohydrate-binding family V/XII"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; 3D domain
FT                   protein; SMART: Carbohydrate-binding family V/XII; KEGG:
FT                   sgr:SGR_6088 putative chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69383"
FT                   /db_xref="GOA:C7PVM7"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM7"
FT                   /inference="protein motif:PFAM:PF02839"
FT                   /protein_id="ACU69383.1"
FT                   /translation="MSLFPIRRRIPEHAPSRRPGPRLRALLGAVALTLTAFGAVGVVAA
FT                   QQASAAGTSSLPTCPFWTNVTPPPRTDTPWVPPLQTAQPVNFSSRLAAPGGVTGTLTGS
FT                   QVDISFNRVAGAQAYRVWRNGQAIAWVSDWGQPALTAVDNAPCQNAYYTFEAMSDQSGA
FT                   DSSLGQMSSPYQLNSDGAVVPWQIPVGSTVTMMVTSYNDGGMTASGYNSQLGVCAVDPR
FT                   VIPWGTYFTVPGYGTCYAADIGTWIQNDTVDVWLPGSQANGWGVQHRTVTIIANPFGGP
FT                   TPPPSSSPSSSPTSSPSSPPGGCTTAAWNSATAYTGGQTVSYGGHTWTAKWWTQGDVPG
FT                   ANSQNVWTDDGPC"
     MSLFPIRRRI PEHAPSRRPG PRLRALLGAV ALTLTAFGAV GVVAAQQASA AGTSSLPTCP        60
     FWTNVTPPPR TDTPWVPPLQ TAQPVNFSSR LAAPGGVTGT LTGSQVDISF NRVAGAQAYR       120
     VWRNGQAIAW VSDWGQPALT AVDNAPCQNA YYTFEAMSDQ SGADSSLGQM SSPYQLNSDG       180
     AVVPWQIPVG STVTMMVTSY NDGGMTASGY NSQLGVCAVD PRVIPWGTYF TVPGYGTCYA       240
     ADIGTWIQND TVDVWLPGSQ ANGWGVQHRT VTIIANPFGG PTPPPSSSPS SSPTSSPSSP       300
     PGGCTTAAWN SATAYTGGQT VSYGGHTWTA KWWTQGDVPG ANSQNVWTDD GPC              353
//

If you have problems or comments...

PBIL Back to PBIL home page