(data stored in ACNUC7421 zone)

EMBL: CP001700.PE429

CP001700.PE429       Location/Qualifiers
FT   CDS             480710..482398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0432"
FT                   /product="cellulose-binding family II"
FT                   /note="PFAM: cellulose-binding family II; Fibronectin type
FT                   III domain protein; SMART: cellulose-binding family II;
FT                   Fibronectin type III domain protein; KEGG:
FT                   fre:Franean1_6988 lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69384"
FT                   /db_xref="GOA:C7PVM8"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM8"
FT                   /inference="protein motif:PFAM:PF00553"
FT                   /protein_id="ACU69384.1"
FT                   /translation="MLRALRASLIAAGAGALLVSGLTIASPTASAATTPTPTATAPTTP
FT                   TATAPTTPTPLPTAVYSKTSDWGSGFQAQYVITNPMSVPLNTWSLQFSLPSTEKITSMW
FT                   GGTDTASGTTHTVLAQSYDTTIAAGASITIGFDGSYSGTYADPSACKLNSDPCDGSADA
FT                   QAPTAPTALTTLSTTSSAASLSWTGSADNVTVAGYNVYSGSTMVATSPGTAATVTGLAP
FT                   STSYSFTVRAVDEAGNLSAPSAAVSATTLASTGGGHLPGVAAPFVDIGAWPTPNLTQIA
FT                   ETTGLRQFSLGFIVNGTATCTPSWFNAYAMSAGFEQSDIATLRAIGGDVKPSFGGEAGT
FT                   ELAQSCTDVPSLTAAYQSAITAYNLTQIDFDIEGSAVADPASIDRRSQAIAALQKNAAA
FT                   AGKPLTVTLTLPILPSGLTTDGLYVVQSAVKYGAKITTVNGMAMDFGDIEAPNPSGKMG
FT                   TYAIDTAQSLHTQLTPLYPALTATQLWNMIGVTPMIGQNDNSSEVFYQTDMHQLLTFAQ
FT                   QQHLGELAFWDVTRDANACTGSLSKCTDIPQTPYEFSKMIAPYQG"
     MLRALRASLI AAGAGALLVS GLTIASPTAS AATTPTPTAT APTTPTATAP TTPTPLPTAV        60
     YSKTSDWGSG FQAQYVITNP MSVPLNTWSL QFSLPSTEKI TSMWGGTDTA SGTTHTVLAQ       120
     SYDTTIAAGA SITIGFDGSY SGTYADPSAC KLNSDPCDGS ADAQAPTAPT ALTTLSTTSS       180
     AASLSWTGSA DNVTVAGYNV YSGSTMVATS PGTAATVTGL APSTSYSFTV RAVDEAGNLS       240
     APSAAVSATT LASTGGGHLP GVAAPFVDIG AWPTPNLTQI AETTGLRQFS LGFIVNGTAT       300
     CTPSWFNAYA MSAGFEQSDI ATLRAIGGDV KPSFGGEAGT ELAQSCTDVP SLTAAYQSAI       360
     TAYNLTQIDF DIEGSAVADP ASIDRRSQAI AALQKNAAAA GKPLTVTLTL PILPSGLTTD       420
     GLYVVQSAVK YGAKITTVNG MAMDFGDIEA PNPSGKMGTY AIDTAQSLHT QLTPLYPALT       480
     ATQLWNMIGV TPMIGQNDNS SEVFYQTDMH QLLTFAQQQH LGELAFWDVT RDANACTGSL       540
     SKCTDIPQTP YEFSKMIAPY QG                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page